BioLongevity Labs – BioLongevity Labs https://biolongevitylabs.com The World’s Most Advanced Research Peptides and Bioregulators Mon, 17 Aug 2026 19:21:37 +0000 en-US hourly 1 https://biolongevitylabs.com/wp-content/uploads/2026/08/bll-favicon.png BioLongevity Labs – BioLongevity Labs https://biolongevitylabs.com 32 32 Regeno Blend (BPC-157, TB-500, Cartalax) 30mg https://biolongevitylabs.com/product/bpc-157-tb-500-cartalax-blend-30mg-10mg-10mg-10mg/ Wed, 22 Oct 2025 19:21:57 +0000 https://biolongevitylabs.com/?post_type=product&p=105727 Triple peptide blend combining BPC-157, TB-500, and Cartalax at 10mg each for in vitro connective tissue studies.

]]>
Peptide Blend Description

This 30mg research blend delivers three complementary peptides in a single vial: BPC-157, TB-500, and Cartalax. Each component contributes distinct mechanisms for laboratory research. BPC-157 (10mg) targets gastric-derived pathways. TB-500 (10mg) provides the 43-amino acid thymosin beta-4 sequence. Cartalax (10mg) offers the bioregulatory AED tripeptide.

Manufactured in USA facilities under pharmaceutical-grade standards with third-party testing verification. Supplied as sterile lyophilized powder at ≥99% purity. Designed for researchers studying connective tissue mechanisms, cellular repair pathways, and fibroblast activity in controlled laboratory settings. For in vitro research applications only.

Product Specifications

Specification BPC-157 TB-500 (Thymosin Beta-4) Cartalax (AED)
Sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser Ala-Glu-Asp
Molecular Formula C62H98N16O22 C212H350N56O78S C12H19N3O8
Molecular Weight 1419.5 g/mol 4963.4 g/mol 333.29 g/mol
CAS Number 137525-51-0 77591-33-4 205640-90-0
PubChem CID 9941957 16132341 87815447
Synonyms Bepecin, Bpc 15, Body protection compound 15, Pentadecapeptide Thymosin Beta 4, Thymosin β4, TB500, Timbetasin T-31, AED, Alanyl-glutamyl-aspartic acid

Product Usage:

This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug.

]]>
KPV (10mg) https://biolongevitylabs.com/product/kpv-10mg/ Fri, 22 Aug 2025 02:34:46 +0000 https://biolongevitylabs.com/?post_type=product&p=75060 KPV (Lys–Pro–Val) is the C-terminal tripeptide fragment of α-melanocyte stimulating hormone (α-MSH). As a small, bioactive peptide, KPV reproduces many of α-MSH’s anti-inflammatory, antimicrobial and tissue-protective activities while avoiding full-length melanocortin receptor signaling in some contexts.]]> KPV Peptide Product Description

KPV (Lys–Pro–Val) is the C-terminal tripeptide fragment of α-melanocyte stimulating hormone (α-MSH). As a small, bioactive peptide, KPV reproduces many of α-MSH’s anti-inflammatory, antimicrobial and tissue-protective activities while avoiding full-length melanocortin receptor signaling in some contexts.

In research settings, KPV has been studied for:

  • Potent anti-inflammatory action — suppresses pro-inflammatory cytokines and leukocyte activation
  • Antimicrobial activity — direct candidacidal and bactericidal effects reported for α-MSH C-terminal fragments including KPV
  • Mucosal and epithelial protection / wound healing — accelerates epithelial repair in corneal and other epithelial models
  • Anti-fibrotic and immunomodulatory effects — reduces fibrosis and shifts macrophage phenotypes in preclinical studies

The KPV peptide sequence is a useful research tool for studying innate immune regulation, mucosal defense and novel anti-inflammatory peptide mechanisms.

Product Specifications

Property Value
Peptide Sequence Lys-Pro-Val (H-Lys-Pro-Val-OH)
Molecular Formula C16H30N4O4
Molecular Weight 342.43 g/mol
CAS Number 67727-97-3
PubChem CID 125672
Synonyms α-MSH(11-13), ACTH(11-13), MSH(11-13)

 

Lyophilized Peptides:

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.

]]>
KLOW Blend (GHK-Cu, BPC-157, TB-500, KPV) 80mg https://biolongevitylabs.com/product/klow-blend-ghk-cu-bpc-157-tb-500-kpv/ Fri, 22 Aug 2025 02:32:12 +0000 https://biolongevitylabs.com/?post_type=product&p=75058 KLOW Blend Product Description

This synthetic peptide blend combines four regenerative peptides into a single vial for studies examining complementary tissue regeneration and inflammation reduction pathways:

  • GHK-Cu up-regulates wound healing processes and drives collagen production, elastin, and angiogenic growth-factor expression in laboratory models.
  • BPC-157 (Body Protection Compound-157) exhibits gastro-protective, soft-tissue repair, and anti-inflammatory actions through nitric-oxide signaling, growth-factor receptor modulation, and cytokine balance.
  • TB-500 (Thymosin Beta-4 Fragment) enhances cell migration and angiogenesis via actin-sequestering and integrin-linked pathways.
  • KPV (Lys-Pro-Val) functions as an anti-inflammatory tripeptide that modulates immune signaling cascades, inhibits inflammatory cytokine production, and regulates mast cell activation without melanocortin receptor binding.

Researchers can examine potential synergy across copper-mediated extracellular-matrix activation (GHK-Cu), cytoprotective signaling (BPC-157), actin-dependent cell motility (TB-500), and immune-modulatory pathways (KPV). In vitro and ex vivo models evaluate collagen deposition rates, angiogenic indices, inflammatory marker expression, and controlled tissue recovery metrics.

Composition: 80 mg lyophilized blend per vial
50 mg GHK-Cu | 10 mg BPC-157 | 10 mg TB-500 | 10 mg KPV

Peptide Information

Property GHK-Cu BPC-157 TB-500 KPV
Sequence  Gly-His-Lys.Cu.xHAc Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser  Lys-Pro-Val
Molecular Formula C₁₄H₂₃CuN₆O₄ C₆₂H₉₈N₁₆O₂₂ C₂₁₂H₃₅₀N₅₆O₇₈S C₁₇H₃₂N₆O₄
Molecular Weight 401.91 g/mol 1419.5 g/mol 4963.55 g/mol 384.48 g/mol
PubChem CID 73587 9941957 16132341 125672
CAS Number 89030-95-5 137525-51-0 77591-33-4 67727-97-3
Synonyms Copper peptide GHK, Cu-GHK, NSC 661251 PL-14736, Body-Protection Compound-157, Bepecin Thymosin-β4 fragment 17-23, TB-500 acetate, Ac-LKKTETQ α-MSH fragment (11–13), Tripeptide KPV, Ac-KPV-NH2

Lyophilized Peptides

All four peptides are supplied in a freeze-dried, filler-free state to maximize stability and preserve chemical integrity during refrigerated or frozen storage. Reconstitute with sterile solvent immediately prior to experimental use and store aliquots at ≤ –20 °C to prevent repeated freeze–thaw cycles.

]]>
NAD+ / MOTS-c / 5-Amino-1MQ Blend – 120mg (100mg / 10mg / 10mg) https://biolongevitylabs.com/product/nad-mots-c-5-amino-1mq-blend-120mg-100mg-10mg-10mg/ Wed, 20 Aug 2025 19:18:28 +0000 https://biolongevitylabs.com/?post_type=product&p=74390 The BioLongevity Labs NAD+/MOTS-c/5-Amino-1MQ Blend unites three distinct compounds that converge on cellular energy, mitochondrial function, and metabolic regulation. Together, their mechanisms are designed to:
  • Enhance mitochondrial and cellular energy balance.
  • Improve metabolic health.
  • Support cognitive and longevity research.
]]>
NAD+ / MOTS-c / 5-Amino-1MQ Peptide Blend Description

The BioLongevity Labs NAD+/MOTS-c/5-Amino-1MQ Blend unites three distinct compounds that converge on cellular energy, mitochondrial function, and metabolic regulation:

  • NAD+ (100 mg) replenishes the central redox cofactor required for metabolism, DNA repair, and sirtuin activation [1][2][3].
  • MOTS-c (10 mg) is a mitochondria-derived peptide that activates AMPK, regulates nuclear gene expression under metabolic stress, and enhances insulin sensitivity [4][5][6].
  • 5-Amino-1MQ (10 mg) inhibits NNMT, raising NAD+ levels while modulating histone methylation and fat metabolism pathways [7][8][9].

Together, their mechanisms are designed to:

  • Enhance mitochondrial and cellular energy balance by restoring NAD+ pools and activating AMPK [1][4][7].
  • Improve metabolic health by reducing adiposity, sustaining muscle function, and optimizing glucose regulation [2][5][8].
  • Support cognitive and longevity research through effects on neuroinflammation, oxidative stress, and cellular senescence [3][6][9].

Peptide Structures

NAD+ (Nicotinamide Adenine Dinucleotide)

  • Molecular Formula: C₂₁H₂₇N₇O₁₄P₂
  • Molecular Weight: 663.43 g/mol
  • PubChem CID: 925
  • CAS Number: 53-84-9
  • Synonyms: β-Nicotinamide adenine dinucleotide, DPN, Coenzyme I, Diphosphopyridine nucleotide

MOTS-c (Mitochondrial Open Reading Frame of the 12S rRNA-c)

  • Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg
  • Molecular Formula: C₁₀₁H₁₅₂N₂₈O₂₂S₂
  • Molecular Weight: 2174.6 g/mol
  • PubChem SID: 255386757
  • CAS Number: 1627580-64-6
  • Synonyms: Human MOTS-c, UNII-A5CV6JFB78, MOTS-c trifluoroacetate salt

5-Amino-1MQ (5-Amino-1-methylquinolinium)

  • Molecular Formula: C₁₀H₁₁N₂
  • Molecular Weight: 159.21 g/mol
  • PubChem CID: 950107
  • CAS Number: —
  • Synonyms: 5-amino-1-methylquinolinium, SCHEMBL6403148, CHEMBL4116828, ZMJBCEIHNOWCMC-UHFFFAOYSA-O, STL196667

This synergistic triad provides a unique investigational platform for metabolism, neuroprotection, and healthy aging research.

Blend Structure

Ingredient Dose (per capsule) Key Actions
NAD+ 100 mg Cofactor in redox metabolism; activates sirtuins & AMPK; supports DNA repair & mitochondrial biogenesis [1][2][3]
MOTS-c 10 mg Mitochondria-encoded peptide; AMPK activation; improves insulin sensitivity; prevents metabolic dysfunction [4][5][6]
5-Amino-1MQ 10 mg NNMT inhibitor; ↑NAD+; ↓adiposity; epigenetic modulation; metabolic & oncology research [7][8][9]

Research Areas

  • Cellular Energy & Mitochondrial Function
  • Metabolic Regulation & Obesity Research
  • Muscle Preservation & Physical Performance
  • Neuroprotection & Cognitive Function
  • Longevity & Anti-Aging Mechanisms
  • Preclinical Cancer Research
]]>
Oxytocin (10mg) https://biolongevitylabs.com/product/oxytocin-10mg/ Thu, 27 Mar 2025 14:46:27 +0000 https://biolongevitylabs.com/?post_type=product&p=19202 Oxytocin is a cyclic nonapeptide of the sequence Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH₂, closed by a disulfide bridge between the cysteine residues at positions 1 and 6 and amidated at the C-terminus. BioLongevity Labs supplies it as a synthetic, lyophilized white powder in a sealed 10mg vial with no added fillers. The compound belongs to the neurohypophysial peptide family and shares close structural homology with vasopressin, differing at only two of nine residues. It is characterized in laboratory work examining oxytocin receptor pharmacology, G protein coupling, and receptor expression across cell and tissue models.

]]>
Oxytocin Product Description

Oxytocin is one of the most extensively characterized peptides in the scientific literature, and its structure was among the first peptide hormone structures ever resolved. The molecule is small, cyclic, and conformationally constrained, which makes it a common reference ligand in receptor binding assays and structure-activity work.

Its research profile centers on the oxytocin receptor (OXTR), a class A G protein-coupled receptor. Because OXTR couples to more than one G protein subtype and has been mapped in a wide range of cultured cell types, the peptide is frequently used as an orthosteric agonist standard in signaling and structural studies.

Compound Specifications

Property Value
Synonyms Oxytocinum; α-Hypophamine; OT; OXT
CAS Number 50-56-6
PubChem CID 439302
Molecular Formula C₄₃H₆₆N₁₂O₁₂S₂
Molecular Weight 1007.19 g/mol
Amino Acid Sequence CYIQNCPLG-NH₂ (Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH₂)
Sequence Length 9 residues, cyclic via a Cys1-Cys6 disulfide bridge
Source Synthetic
InChIKey XNOPRXBHLZRZKH-DSZYJQQASA-N
Purity ≥99% (HPLC)
Appearance Lyophilized white powder
Solubility Soluble in water and in dilute acetic acid
Storage -20°C, protect from light

Oxytocin Peptide Structure

Oxytocin.png

Source: PubChem

Storage and Handling

  • Store the lyophilized compound at -20°C, sealed and protected from light.
  • After reconstitution, store at 2°C to 8°C and use promptly.
  • The lyophilized powder is hygroscopic. Allow the vial to reach room temperature before opening to limit moisture uptake.
  • Maintain aseptic handling to preserve compound integrity.

Lyophilized Format

This compound ships in lyophilized (freeze-dried) form. Freeze-drying supports long-term storage stability and preserves compound integrity. No fillers are added.

Research Use Disclaimer

Oxytocin is supplied for research use only. It is not a drug, food, cosmetic, or dietary supplement, has not been evaluated by the FDA, and is for research use only. By purchasing, the buyer confirms the compound will be used solely for in vitro research.

]]>
PNC-27 (10mg) https://biolongevitylabs.com/product/pnc-27-10mg/ Thu, 27 Mar 2025 14:43:38 +0000 https://biolongevitylabs.com/?post_type=product&p=19200 PNC-27 Product Description

PNC-27 is a synthetic peptide designed to selectively kill cancer cells by targeting a protein called HDM-2 (also known as MDM2) found on the membranes of many cancer cells. It works by binding to membrane-bound HDM-2, forming pores in the cancer cell membrane, and causing rapid cell death through necrosis, while sparing normal cells.

PNC-27 is derived from the p53 protein’s HDM-2 binding domain (amino acids 12-26) and is linked to a membrane-penetrating sequence, allowing it to enter and act on cancer cell membranes. The peptide binds specifically to HDM-2 present on the surface of cancer cells, not normal cells. This binding leads to the formation of transmembrane pores, disrupting the cell membrane and causing cell lysis and necrosis, independent of the p53 pathway.

Peptide Information

Property Value
Peptide Sequence Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly
Molecular Formula C188H293N53O44S
Molecular Weight 4029.2 g/mol
CAS Number 1159861-00-3
Synonyms H-PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG-OH, PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG-acid, H-Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly-OH, A6, Paralit

PNC-27 Peptide Structure

32 Amino acid peptide.png

Source: PubChem

Lyophilized Peptides:

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.

]]>
5-Amino-1MQ (10mg) https://biolongevitylabs.com/product/5-amino-1mq-10mg/ Wed, 26 Mar 2025 01:48:11 +0000 https://biolongevitylabs.com/?post_type=product&p=18919 5-Amino-1-methylquinolinium (5-Amino-1MQ or 5-AMQ) is a small-molecule NNMT inhibitor studied for in vitro applications in metabolic and cellular longevity research.

]]>
5-Amino-1MQ Product Description

5-Amino-1MQ is a synthetic small molecule that inhibits the enzyme nicotinamide N-methyltransferase (NNMT). By blocking NNMT, it shifts intracellular NAD+ and S-adenosylmethionine (SAM) levels, two cofactors tied to energy metabolism, redox balance, and gene regulation in laboratory models.

In cultured cells and rodent models, researchers have used 5-Amino-1MQ to study lipid metabolism, adipose tissue biology, and cellular aging pathways. This methylquinolinium derivative is a research compound of interest for fundamental studies of metabolic regulation.

BioLongevity Labs supplies 5-Amino-1MQ for research use only.

Compound Information

Property Value
Compound Name 5-Amino-1-methylquinolinium
Molecular Formula C10H11N2
Molecular Weight 159.21 g/mol
PubChem CID 950107
Compound Class Small-molecule NNMT inhibitor
Synonyms 5-amino-1-methylquinolinium, 5-AMQ, SCHEMBL6403148, CHEMBL4116828, STL196667

5-Amino-1MQ Peptide Structure

5-Amino-1-methylquinolinium.png

Source: PubChem

Lyophilized Format

This compound ships in lyophilized (freeze-dried) form. Freeze-drying supports long-term storage stability and preserves compound integrity. No fillers are added.

Product Usage

This product is intended as a research chemical only. This designation allows use strictly for in vitro testing and laboratory experimentation. All product information on this website is for educational purposes only. This product should be handled only by licensed, qualified professionals. It is not a drug, food, or cosmetic and may not be misbranded, misused, or mislabeled.

Research Applications

Research Area Model Focus
NNMT enzyme inhibition Selectivity and membrane-permeability assays in cell-based systems
NAD+ and SAM metabolism Cofactor level measurement in cultured adipocytes
Lipid metabolism Lipogenesis assays in adipocyte cultures
Metabolic research models Body composition and glucose handling in DIO rodent models
Cellular proliferation Anti-proliferative screening in cancer cell lines
Pharmacokinetics Tissue distribution and exposure profiling in rodent models

Storage and Handling

Store lyophilized 5-Amino-1MQ at -20°C, protected from light and moisture. In freeze-dried form, the compound stays stable for extended periods under proper storage. After reconstitution, keep refrigerated and use within a short window under sterile conditions. Handle only in a controlled laboratory setting.

]]>
PEG-MGF (5mg) https://biolongevitylabs.com/product/peg-mgf-5mg/ Wed, 26 Mar 2025 01:46:34 +0000 https://biolongevitylabs.com/?post_type=product&p=18918 PEG-MGF Product Description

PEG MGF (Pegylated Mechano Growth Factor) is a synthetic, modified form of MGF, which is a split variant of Insulin-like Growth Factor-1 (IGF-1). Through a process called pegylation, a polyethylene glycol (PEG) molecule is attached to the MGF peptide, significantly enhancing its stability for research use.

This peptide preferentially targets recently stressed or damaged muscle cell tissue, making it particularly suited for laboratory studies investigating muscle growth, repair and recovery.

Peptide Information

Property Value
Peptide Sequence PEG-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys
Molecular Formula C121H200N42O39
Molecular Weight 2900 g/mol
CAS Number 108174-48-7
PubChem CID 178101669
Synonyms IGF-1 Ec E-peptide, MGF-E, Pegylated MGF, PEG-MGF-Ct24E, PEG Myotrophin

Lyophilized Peptides:

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.

]]>
GLOW Blend (BPC-157 TB-500 GHK-CU) (70mg) https://biolongevitylabs.com/product/glow-blend-ghk-cu-bpc-157-tb-500/ Wed, 26 Mar 2025 01:38:53 +0000 https://biolongevitylabs.com/?post_type=product&p=18915 GLOW peptide blend is a three-component research formulation that combines the copper tripeptide GHK-Cu, the pentadecapeptide BPC-157, and the thymosin beta-4 peptide TB-500 in a single vial. All three components are produced through controlled synthesis and supplied together as one lyophilized powder totaling 70 mg per vial. The blend is characterized for laboratory work on tissue-repair signaling, vascular formation, and extracellular-matrix models. It is offered for research use only.

]]>
What is the GLOW Blend?

GLOW pairs three peptides that are each studied in separate lines of regenerative research. GHK-Cu is a copper-binding tripeptide investigated in connective-tissue and matrix-remodeling models. BPC-157 is a 15-residue peptide studied in angiogenesis and cell-migration research. TB-500 corresponds to the actin-binding region of thymosin beta-4 and is examined in cytoskeletal-dynamics models.

Combining the three in one vial lets researchers study how copper-mediated matrix activity, cytoprotective signaling, and actin-dependent motility behave alongside one another under controlled in vitro conditions.

Each vial holds 70 mg of lyophilized blend: 50 mg GHK-Cu, 10 mg BPC-157, and 10 mg TB-500.

Compound Information

Property GHK-Cu BPC-157 TB-500
Compound Class Copper tripeptide complex Pentadecapeptide Thymosin beta-4 peptide
Sequence Gly-His-Lys (Cu complex) Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser
Sequence Length 3 residues 15 residues 43 residues
Molecular Formula C₁₄H₂₄CuN₆O₄ C₆₂H₉₈N₁₆O₂₂ C₂₁₂H₃₅₀N₅₆O₇₈S
Molecular Weight 403.9 g/mol 1419.5 g/mol 4963.4 g/mol
CAS Number 89030-95-5 137525-51-0 77591-33-4
PubChem CID 378611 9941957 16132341
Source Synthetic Synthetic Synthetic
Purity ≥99% (HPLC) ≥99% (HPLC) ≥99% (HPLC)
Appearance Lyophilized powder Lyophilized powder Lyophilized powder
Solubility Soluble in water Soluble in water Soluble in water

Blend composition: 70 mg total per vial (50 mg GHK-Cu, 10 mg BPC-157, 10 mg TB-500). Storage: -20°C, protect from light.

Storage and Handling

  • Store the lyophilized blend at -20°C, protected from light.
  • After reconstitution with sterile solvent, store refrigerated and use promptly.
  • Aliquot to avoid repeated freeze-thaw cycles.
  • Maintain aseptic handling to preserve compound integrity.

Lyophilized Format

This blend ships in lyophilized (freeze-dried) form. Freeze-drying supports long-term storage stability and preserves compound integrity. No fillers are added.

Research Use Disclaimer

GLOW peptide blend is supplied for research use only. It is not a drug, food, cosmetic, or dietary supplement, has not been evaluated by the FDA. By purchasing, the buyer confirms the compound will be used solely for in vitro research.

]]>
Cagrilintide (Amylin Analog) (5mg) https://biolongevitylabs.com/product/cagrilintide-amylin-analog/ Tue, 25 Feb 2025 21:56:35 +0000 https://biolongevitylabs.com/?post_type=product&p=12461 Cagrilintide Description

Cagrilintide is a novel long-acting amylin analog featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.

Peptide Information

Property Value
Peptide Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula C194H312N54O59S2
Molecular Weight 4409 g/mol
CAS Number 1415456-99-3
PubChem CID 171397054
Synonyms 1415456-99-3, Cagrilintide [INN], AO43BIF1U8, LDERDVMBIYGIOI-IZVMHKDJSA-N

Cagrilintide Peptide Structure

Image showing Cagrilintide peptide structure

Source: PubChem

Lyophilized Peptides:

Our cagrilintide is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.

]]>