Tesamorelin Description
Tesamorelin is a synthetic peptide analog belonging to the GHRH-analog family, sharing the core 44-amino acid sequence of the endogenous releasing factor. The N-terminal lipid modification lengthens its serum persistence relative to native GHRH, which makes it a stable reference compound for laboratory work.
In research settings, the peptide is studied for how it interacts with pituitary GHRH receptors and the downstream growth hormone and IGF-1 signaling cascade. This places it in the same research area as other secretagogue compounds such as CJC-1295 and Ipamorelin.
Each batch is synthesized in a USA-registered GMP facility and characterized by HPLC and LC-MS. A batch-specific Certificate of Analysis is available before purchase.
Compound Specifications
| Property |
Value |
| CAS Number |
901758-09-6 (acetate) |
| PubChem CID |
44147413 |
| Molecular Formula |
C₂₂₃H₃₇₀N₇₂O₆₉S |
| Molecular Weight |
5196 g/mol |
| UNII |
LGW5H38VE3 |
| Amino Acid Sequence |
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| Sequence (3-letter) |
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu |
| Sequence Length |
44 residues |
| N-Terminal Modification |
trans-3-hexenoic acid |
| Counterion / Salt Form |
Acetate |
| Source |
Synthetic |
| Purity |
≥99% (HPLC) |
| Appearance |
Lyophilized white powder |
| Solubility |
Soluble in water; sterile aqueous solution after reconstitution |
| Storage |
-20°C, protect from light |
Storage and Handling
- Store the lyophilized compound at -20°C, protected from light.
- After reconstitution, store at 2°C to 8°C and use promptly.
- Maintain aseptic handling to preserve compound integrity.
Peptide Structure
Source: PubChem
Lyophilized Format
This compound ships in lyophilized (freeze-dried) form. Freeze-drying supports long-term storage stability and preserves compound integrity. No fillers are added.
Research Use Disclaimer
Tesamorelin is supplied for research use only. It is not a drug, food, cosmetic, or dietary supplement, has not been evaluated by the FDA, and is for research use only. By purchasing, the buyer confirms the compound will be used solely for in vitro research.
Tesamorelin Research
Tesamorelin is a stabilized analog of growth hormone-releasing hormone. The trans-3-hexenoic acid group at the N-terminus of its 44-residue sequence lengthens serum persistence relative to native GHRH. In research models the compound binds pituitary GHRH receptors and is associated with pulsatile release of growth hormone, with downstream changes in insulin-like growth factor-1 (IGF-1) and IGF binding protein-3 [1]. A broader overview of the compound sits in the Tesamorelin research guide.
In adult study populations, reductions in visceral adipose tissue have been reported alongside changes in triglyceride levels and preservation of glucose homeostasis, characterized through combined anabolic and lipolytic dynamics [2].
Beyond adipose quantity, research has examined the compound’s influence on tissue-level gene expression and composition.
Hepatic Gene-Pathway Signatures
A gene-set analysis of paired liver specimens reported increased expression of gene sets involved in oxidative phosphorylation and decreased expression of gene sets linked to inflammation, tissue repair, and cell division. These shifts correlated with a fibrosis-related gene score in the same analysis [3].
Separate analyses looked at fat quality and skeletal muscle. Adipose tissue density increased independent of changes in fat quantity [4], and truncal muscle density and area increased among study populations with reduced visceral adipose tissue [5]. A 2026 meta-analysis of randomized trials aggregated changes in body composition, hepatic fat fraction, and IGF-1 across adult study populations [6].
| Research Area |
In Vitro Application |
| GHRH receptor signaling |
Assays of pituitary GHRH receptor binding and cAMP response in cell models |
| Growth hormone / IGF-1 axis |
Model systems examining growth hormone pulsatility and downstream IGF-1 signaling |
| Adipose tissue metabolism |
Cell-model study of lipolytic pathways and adipocyte lipid handling |
| Hepatic lipid pathways |
Gene-expression analysis of oxidative phosphorylation and lipid-metabolism gene sets |
| Peptide characterization |
Analytical study of a lipid-modified GHRH analog by HPLC and LC-MS |
References
- Sattler, F. R. (2013). Growth hormone in the aging male. Best Practice & Research Clinical Endocrinology & Metabolism, 27(4), 541-555. https://doi.org/10.1016/j.beem.2013.05.003
- Stanley, T. L., Falutz, J., Marsolais, C., Morin, J., Soulban, G., Mamputu, J.-C., Assaad, H., Turner, R., & Grinspoon, S. K. (2012). Reduction in visceral adiposity is associated with an improved metabolic profile in HIV-infected patients receiving tesamorelin. Clinical Infectious Diseases, 54(11), 1642-1651. https://doi.org/10.1093/cid/cis251
- Fourman, L. T., Billingsley, J. M., Agyapong, G., Ho Sui, S. J., Feldpausch, M. N., Purdy, J., Zheng, I., Pan, C. S., Corey, K. E., Torriani, M., Kleiner, D. E., Hadigan, C. M., Stanley, T. L., Chung, R. T., & Grinspoon, S. K. (2020). Effects of tesamorelin on hepatic transcriptomic signatures in HIV-associated NAFLD. JCI Insight, 5(16), e140134. https://doi.org/10.1172/jci.insight.140134
- Lake, J. E., La, K., Erlandson, K. M., Adrian, S., Yenokyan, G., Scherzinger, A., Dubé, M. P., Stanley, T., Grinspoon, S., Falutz, J., Mamputu, J.-C., Marsolais, C., McComsey, G. A., & Brown, T. T. (2021). Tesamorelin improves fat quality independent of changes in fat quantity. AIDS, 35(9), 1395-1402. https://doi.org/10.1097/QAD.0000000000002897
- Adrian, S., Scherzinger, A., Sanyal, A., Lake, J. E., Falutz, J., Dubé, M. P., Stanley, T., Grinspoon, S., Mamputu, J.-C., Marsolais, C., Brown, T. T., & Erlandson, K. M. (2019). The growth hormone releasing hormone analogue, tesamorelin, decreases muscle fat and increases muscle area in adults with HIV. The Journal of Frailty & Aging, 8(3), 154-159. https://doi.org/10.14283/jfa.2018.45
- Badran, A. S., Helal, A., Shata, K. S., & Ayesh, H. (2026). Body composition, hepatic fat, metabolic, and safety outcomes of tesamorelin, a GHRH analogue, in HIV-associated lipodystrophy: A meta-analysis of randomized controlled trials. Obesity Research & Clinical Practice, 20(1), 2-12. https://doi.org/10.1016/j.orcp.2026.01.002
Certificate of Analysis (COA) for Every Batch
A Certificate of Analysis (COA) is a document that verifies a compound’s identity, purity, and batch quality through independent laboratory testing. Every compound from BioLongevity Labs ships with a COA tied to its specific batch, so researchers can confirm exactly what they received before it enters a protocol.
Each COA reports results from third-party laboratory analysis, including:
- Ultra-high-performance liquid chromatography with mass spectrometry (UHPLC-MS) for purity, typically confirmed at 99% or higher
- Mass identification for molecular confirmation and content quantitation
- Endotoxin quantitation by Limulus amebocyte lysate (LAL) assay where applicable
- Visual and physical characterization of the finished material
How to verify a COA independently
Every certificate can be checked against the issuing laboratory’s own records, not just the copy hosted here. Verification does not depend on BioLongevity Labs.
- MDx BioAnalytical Laboratory certificates carry a QC tracking number and a search code. Newer certificates also carry a QR code. Scan the code, or enter the search code at mdxbiolabs.com, to pull the official record.
- BioRegen reports of analysis carry a Report ID and a Validation Key. Scan the QR code on the certificate to open the official record, or reference both identifiers when contacting the laboratory at the address printed on the report.
- SafeCert Labs certificates, which appear on a number of earlier batches, carry a COA number and the signature of the reporting chemist. Reference that number when requesting confirmation from the laboratory directly.
Batches are frequently tested by both laboratories independently. When two certificates exist for the same lot, each one resolves at its own issuing laboratory, which lets a researcher confirm the same material twice through two unrelated sources.
COAs are sourced from independent certified labs rather than in-house testing alone, giving researchers a verifiable record of molecular integrity for each batch. All compounds are supplied for research use only.
Review the COAs for this batch below, or browse the full COA library.
Tesamorelin (261477)
Tesamorelin (261414)
Tesamorelin (260400)
Tesamorelin (12031)
Endotoxin Tesamorelin
Tesamorelin (251539)
Tesamorelin (251539E)
Tesamorelin
Tesamorelin BL-ENDO-250409-005
Tesamorelin(10166)
Tesamorelin(10174)
×
![]()
